PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00067590001
Common NameGSBRNA2T00067590001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Dof
Protein Properties Length: 386aa    MW: 42560.1 Da    PI: 9.4229
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00067590001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof122.61.3e-38122181261
               zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                          ++k+l+cprC+s+ntkfCyynny++sqPryfC++C+ryWt+GG++rnvPvG+grrknk +
  GSBRNA2T00067590001 122 PDKILPCPRCESANTKFCYYNNYNVSQPRYFCRNCQRYWTAGGSMRNVPVGSGRRKNKGW 181
                          7899*****************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074786.0E-30119179IPR003851Zinc finger, Dof-type
PfamPF027017.8E-32124179IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.546126180IPR003851Zinc finger, Dof-type
PROSITE patternPS013610128164IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 386 aa     Download sequence    Send to blast
MSKSRDIKLF GTTITSLSSV NHYDPSPWPA AHGGSDQSKE ASSSSSSSCS PSIRPDRVLA  60
AKNGQENSRF KDPYTLSHLN EPPKAASEIL SPISSKTNTD QQSELTTTST SAADKPTTLK  120
KPDKILPCPR CESANTKFCY YNNYNVSQPR YFCRNCQRYW TAGGSMRNVP VGSGRRKNKG  180
WPSSNHYLQV TSEDYENNNN LGTILSFGSS ESSVTETGKH QPGDTKITAD SASQEQRTRQ  240
GFLPPQVIFP NNSSPWPYQW SPTGPNANFY PIPFYWGCTV PVWPTSETPP CLGKRSRDQT  300
EGGMKDATTI TRARVVSETI SISEATKSTV WSPKPERKTE GFSLFNGFET KGSNRRSLVP  360
ETSINIQANP AAMSRSMNFR ENMQQ*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.137286e-52leaf| seed
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3534820.0AK353482.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-45-E10.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013693924.10.0PREDICTED: cyclic dof factor 5-like
SwissprotQ9SEZ30.0CDF5_ARATH; Cyclic dof factor 5
TrEMBLA0A078JM290.0A0A078JM29_BRANA; BnaC06g43390D protein
STRINGBra003994.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM130901729
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69570.10.0Dof family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]